General Information

  • ID:  hor003092
  • Uniprot ID:  E9FQN7(87-97)
  • Protein name:  short neuropeptide F
  • Gene name:  NA
  • Organism:  Daphnia pulex (Water flea)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Daphnia (genus), Daphniidae (family), Anomopoda (infraorder), Cladocera (suborder), Diplostraca (order), Phyllopoda (subclass), Branchiopoda (class), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SDRSPSLRLRF
  • Length:  11(87-97)
  • Propeptide:  MELCPRINCWTTRTVLLVTFVVFLIHQDIQQNIASASPTPLLSGFEDYSEDRLNGEQPSLYELLLQREMLADKLDSEGRGHLIVRKSDRSPSLRLRFGRRADPDVPRVSAASNQHD
  • Signal peptide:  MELCPRINCWTTRTVLLVTFVVFLIHQDIQ
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E9FQN7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003092_AF2.pdbhor003092_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 151204 Formula: C57H96N20O17
Absent amino acids: ACEGHIKMNQTVWY Common amino acids: RS
pI: 12.2 Basic residues: 3
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -96.36 Boman Index: -5086
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70.91
Instability Index: 13465.45 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21830762
  • Title:  Genomics, Transcriptomics, and Peptidomics of Daphnia Pulex Neuropeptides and Protein Hormones